Rabbit Anti-ACAA2 Antibody 370874 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-ACAA2 Antibody

Western blot analysis of ACAA2 expression in rat lung extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). ACAA2 at 42KD was detected using ACAA2 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-ACAA2 Antibody

ACAA2 was detected in paraffin-embedded sections of human intestianl cancer tissues using ACAA2 at 1ug/mL. The immunohistochemical section was developed using SABC method.

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-ACAA2 Antibody

The Rabbit Anti-ACAA2 Antibody from United States Biological is a Rabbit Polyclonal antibody to ACAA2. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Rabbit Anti-ACAA2 Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemRabbit Anti-ACAA2 Antibody
CompanyUnited States Biological
Price Pricing Info Supplier Page View Company Product Page
Catalog Number370874
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to a sequence in the middle region of human ACAA2 (aa207-242, EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by 1aa, and from the related rat sequence by 2aa
TargetACAA2
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameacetyl-CoA acyltransferase 2
NCBI Gene AliasesDSAEC
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!